Learn More
Abnova™ Human PHACTR3 Partial ORF (NP_542403.1, 92 a.a. - 179 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00116154-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
The protein encoded by this gene is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1. Alternative splicing at this locus results in several transcript variants encoding different isoforms. [provided by RefSeq]
Sequence: TSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPPTPKSETLTSEDAQPGSPLATGTDQVSLDKPLSSAAHLDDSpecifications
NP_542403.1 | |
Liquid | |
116154 | |
PHACTR3 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
C20orf101/H17739/MGC117178/SCAPIN1/SCAPININ | |
PHACTR3 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.42kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
TSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPPTPKSETLTSEDAQPGSPLATGTDQVSLDKPLSSAAHLDD | |
RUO | |
PHACTR3 | |
Wheat Germ (in vitro) | |
GST |