missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PCTK2 Partial ORF (NP_002586, 426 a.a. - 523 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00005128-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16024515

  • 341.70€ / 10µg

Estimated Shipment: 20-01-2022
Add to basket

Description

Description

The protein encoded by this gene belongs to the cdc2/cdkx subfamily of the ser/thr family of protein kinases. It has similarity to rat protein which is thought to play a role in terminally differentiated neurons. [provided by RefSeq]

Sequence: NFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRVSAEEAMKHVYFRSLGPRIHALPESVSIFSLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF
Specifications

Specifications

NP_002586
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
NFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRVSAEEAMKHVYFRSLGPRIHALPESVSIFSLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF
RUO
PCTK2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5128
PCTK2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PCTAIRE2
PCTK2
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers