missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NHLH2 Partial ORF (NP_005590.1, 36 a.a. - 135 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00004808-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16014465

  • 341.70€ / 10µg

Estimated Shipment: 25-01-2022
Add to basket

Description

Description

Sequence: SDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV
Specifications

Specifications

NP_005590.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue
SDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV
RUO
NHLH2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
4808
NHLH2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HEN2/KIAA0490/NSCL2/bHLHa34
NHLH2
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers