missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NEUROD6 Partial ORF (NP_073565.2, 191 a.a. - 290 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00063974-Q03.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16025625

  • 341.70€ / 10µg

Estimated Shipment: 21-01-2022
Add to basket

Description

Description

NEUROD6 is a member of the NEUROD (NEUROD1; MIM 601724) family of basic helix-loop-helix (bHLH) transcription factors (Guo et al., 2002 [PubMed 12357074]).[supplied by OMIM]

Sequence: GQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMH
Specifications

Specifications

NP_073565.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue
GQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMH
RUO
NEUROD6
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
63974
NEUROD6 (Human) Recombinant Protein (Q03)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Atoh2/MATH2/Math-2/NEX1M/bHLHa2
NEUROD6
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers