missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MTTP Partial ORF (NP_000244.1, 794 a.a. - 894 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00004547-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16161455

  • 359.00€ / 10µg

Estimated Shipment: 24-08-2022
to see stock.
Add to basket

Description

Description

MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia. [provided by RefSeq]

Sequence: SSFVKAGLETSTETEAGLEFISTVQFSQYPFLVCMQMDKDEAPFRQFEKKYERLSTGRGYVSQKRKESVLAGCEFPLHQENSEMCKVVFAPQPDSTSSGWF
Specifications

Specifications

NP_000244.1
Liquid
4547
MTTP (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ABL/MGC149819/MGC149820/MTP
MTTP
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.85kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SSFVKAGLETSTETEAGLEFISTVQFSQYPFLVCMQMDKDEAPFRQFEKKYERLSTGRGYVSQKRKESVLAGCEFPLHQENSEMCKVVFAPQPDSTSSGWF
RUO
MTTP
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers