missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MGC45806 Partial ORF (NP_689517, 46 a.a. - 105 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00115273-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16015765

  • 341.70€ / 10µg

Estimated Shipment: 25-01-2022
Add to basket

Description

Description

Sequence: SVKNNCNVDLAFDTLADAIQQALQQGDIKLEEGWGGVRLIHKTQIPRSPSRKQHSGPCQC
Specifications

Specifications

NP_689517
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.34kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SVKNNCNVDLAFDTLADAIQQALQQGDIKLEEGWGGVRLIHKTQIPRSPSRKQHSGPCQC
RUO
RAB42
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
115273
RAB42 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC45806/RP4-669K10.6
RAB42
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers