missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MGC2749 Full-length ORF (NP_076974.1, 1 a.a. - 176 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00079036-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16194033

  • 349.00€ / 10µg

Estimated Shipment: 31-10-2023
to see stock.
Add to basket

Description

Description

Sequence: MDLPDSASRVFCGRILSMVNTDDVNAIILAQKNMLDRFEKTNEMLLNFNNLSSARLQQMSERFLHHTRTLVEMKRDLDSIFRRIRTLKGKLARQHPEAFSHIPEASFLEEEDEDPIPPSTTTTIATSEQSTGSCDTSPDTVSPSLSPGFEDLSHVQAGSPAINGRSQTDDEEMTGE
Specifications

Specifications

NP_076974.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
46kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ25480/MGC2749/MST096/MSTP096
C19orf50
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
79036
MGC2749 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MDLPDSASRVFCGRILSMVNTDDVNAIILAQKNMLDRFEKTNEMLLNFNNLSSARLQQMSERFLHHTRTLVEMKRDLDSIFRRIRTLKGKLARQHPEAFSHIPEASFLEEEDEDPIPPSTTTTIATSEQSTGSCDTSPDTVSPSLSPGFEDLSHVQAGSPAINGRSQTDDEEMTGE
RUO
C19orf50
Wheat Germ (in vitro)
GST
Liquid
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers