missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MEF2B Partial ORF (NP_005910.1, 165 a.a. - 235 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00004207-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16034385

  • 341.70€ / 10µg

Estimated Shipment: 21-01-2022
Add to basket

Description

Description

This gene represents numerous read-through transcripts that span geneID:729991 and 100271849. Many read-through transcripts are predicted to be nonsense-mediated decay (NMD) candidates, and are thought to be non-coding. Some transcripts are predicted to be capable of translation reinitation at a downstream AUG, resulting in expression of at least one isoform of myocyte enhancer factor 2B (MEF2B) from this read-through locus. At least one additional MEF2B variant and isoform can be expressed from a downstream promoter, and is annotated on geneID:100271849. [provided by RefSeq]

Sequence: SRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNP
Specifications

Specifications

NP_005910.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.44kDa
12.5% SDS-PAGE Stained with Coomassie Blue
SRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNP
RUO
MEF2B
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
4207
MEF2B (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ32599/FLJ46391/MGC189732/MGC189763/RSRFR2
MEF2B
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers