missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human MAD2L1BP Partial ORF (NP_055443.1, 171 a.a. - 274 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifications
Accession Number | NP_055443.1 |
---|---|
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 9587 |
Molecular Weight (g/mol) | 37.18kDa |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16160996
|
Abnova™
H00009587-Q01.25UG |
25 ug |
508.00€
25µg |
Estimated Shipment: 07-05-2024
Log in to see stock. |
|||||
16150996
|
Abnova™
H00009587-Q01.10UG |
10 ug |
335.00€
10µg |
Estimated Shipment: 07-05-2024
Log in to see stock. |
|||||
Description
The protein encoded by this gene was identified as a binding protein of the MAD2 mitotic arrest deficient-like 1 (MAD2/MAD2L1). MAD2 is a key component of the spindle checkpoint that delays the onset of anaphase until all the kinetochores are attached to the spindle. This protein may interact with the spindle checkpoint and coordinate cell cycle events in late mitosis. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]
Sequence: LLAPYSVDQSLSTAACLRRLFRAIFMADAFSELQAPPLMGTVVMAQGHRNCGEDWFRPKLNYRVPSRGHKLTVTLSCGRPSIRTTAWEDYIWFQAPVTFKGFRESpecifications
NP_055443.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.18kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CMT2/KIAA0110/MGC11282/RP1-261G23.6 | |
MAD2L1BP | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
9587 | |
MAD2L1BP (Human) Recombinant Protein (Q01) | |
LLAPYSVDQSLSTAACLRRLFRAIFMADAFSELQAPPLMGTVVMAQGHRNCGEDWFRPKLNYRVPSRGHKLTVTLSCGRPSIRTTAWEDYIWFQAPVTFKGFRE | |
RUO | |
MAD2L1BP | |
Wheat Germ (in vitro) | |
GST | |
Liquid |