missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human LTBP2 Partial ORF (NP_000419, 1709 a.a. - 1818 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifications
Accession Number | NP_000419 |
---|---|
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 4053 |
Molecular Weight (g/mol) | 37.84kDa |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16167471
|
Abnova™
H00004053-Q01.25UG |
25 ug |
508.00€
25µg |
Estimated Shipment: 07-05-2024
Log in to see stock. |
|||||
16157471
|
Abnova™
H00004053-Q01.10UG |
10 ug |
335.00€
10µg |
Estimated Shipment: 07-05-2024
Log in to see stock. |
|||||
Description
The protein encoded by this gene belongs to the family of latent transforming growth factor (TGF)-beta binding proteins (LTBP), which are extracellular matrix proteins with multi-domain structure. This protein is the largest member of the LTBP family possessing unique regions and with most similarity to the fibrillins. It has thus been suggested that it may have multiple functions: as a member of the TGF-beta latent complex, as a structural component of microfibrils, and a role in cell adhesion. [provided by RefSeq]
Sequence: LQPSELQPHYVASHPEPPAGFEGLQAEECGILNGCENGRCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEGSYRCHCSPGYVAEAGPPHCTSpecifications
NP_000419 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.84kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
C14orf141/LTBP3/MSTP031 | |
LTBP2 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
4053 | |
LTBP2 (Human) Recombinant Protein (Q01) | |
LQPSELQPHYVASHPEPPAGFEGLQAEECGILNGCENGRCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEGSYRCHCSPGYVAEAGPPHCT | |
RUO | |
LTBP2 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |