Learn More
Abnova™ Human LARP2 Full-length ORF (AAH30516.1, 1 a.a. - 201 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifications
Accession Number | AAH30516.1 |
---|---|
For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 55132 |
Molecular Weight (g/mol) | 50.5kDa |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16121153
|
Abnova™
H00055132-P01.25UG |
25 ug |
508.00€
25µg |
Estimated Shipment: 31-05-2024
Log in to see stock. |
|||||
16111153
|
Abnova™
H00055132-P01.10UG |
10 ug |
335.00€
10µg |
Estimated Shipment: 31-05-2024
Log in to see stock. |
|||||
Description
This gene encodes a protein containing domains found in the La related protein of Drosophila melanogaster. La motif-containing proteins are thought to be RNA-binding proteins, where the La motif and adjacent amino acids fold into an RNA recognition motif. The La motif is also found in proteins unrelated to the La protein. Alternative splicing has been observed at this locus and three variants, encoding distinct isoforms, are described. Additional splice variation has been identified but the full-length nature of these transcripts has not been determined. [provided by RefSeq]
Sequence: MDSRDHGPGTSSVSTSNASPSEGAPLAGSYGCTPHSFPKFQHPSHELLKENGFTQQVYHKYRRRCLSERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFRQLAWEDAKENYRYGLECLFRFYSYGLEKKFRREIFQDFQEETKKDYESGQLYGLEKFWAYLKYSQSKTQSIDPKLQEYLCSFKRLEDFRVDEADPIESpecifications
AAH30516.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
50.5kDa | |
Glutathione Sepharose 4 Fast Flow | |
MDSRDHGPGTSSVSTSNASPSEGAPLAGSYGCTPHSFPKFQHPSHELLKENGFTQQVYHKYRRRCLSERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFRQLAWEDAKENYRYGLECLFRFYSYGLEKKFRREIFQDFQEETKKDYESGQLYGLEKFWAYLKYSQSKTQSIDPKLQEYLCSFKRLEDFRVDEADPIE | |
RUO | |
LARP2 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, Protein Array, ELISA, Western Blot | |
55132 | |
LARP2 (Human) Recombinant Protein (P01) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
DKFZp686L13217/MGC117277/MGC75174 | |
LARP2 | |
Recombinant | |
wheat germ expression system |