missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human KPNA3 Partial ORF (NP_002258, 422 a.a. - 521 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003839-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16127181

  • 359.00€ / 10µg

Estimated Shipment: 27-09-2022
to see stock.
Add to basket

Description

Description

The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion while larger molecules are transported by an active process. The protein encoded by this gene belongs to the importin alpha family, and is involved in nuclear protein import. [provided by RefSeq]

Sequence: VKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEIIDQYFSGDDIDEDPCLIPEATQGGTYNFDPTANLQTKEFNF
Specifications

Specifications

NP_002258
Liquid
3839
KPNA3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
IPOA4/SRP1/SRP1gamma/SRP4/hSRP1
KPNA3
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
VKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEIIDQYFSGDDIDEDPCLIPEATQGGTYNFDPTANLQTKEFNF
RUO
KPNA3
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers