Learn More
Abnova™ Human KCNK12 Partial ORF (NP_071338, 166 a.a. - 215 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00056660-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. [provided by RefSeq]
Sequence: ERIISLLAFIMRACRERQLRRSGLLPATFRRGSALSEADSLAGWKPSVYHSpecifications
NP_071338 | |
Liquid | |
56660 | |
KCNK12 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
THIK-2/THIK2 | |
KCNK12 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
31.24kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
ERIISLLAFIMRACRERQLRRSGLLPATFRRGSALSEADSLAGWKPSVYH | |
RUO | |
KCNK12 | |
Wheat Germ (in vitro) | |
GST |