missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ITGB3BP Full-length ORF (NP_055103.3, 1 a.a. - 177 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00023421-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16107302

  • 528.00€ / 25µg

Estimated Shipment: 07-07-2023
to see stock.
Add to basket

Description

Description

Sequence: MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTKELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN
Specifications

Specifications

NP_055103.3
Liquid
23421
ITGB3BP (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTKELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN
RUO
ITGB3BP
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
46.6kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CENP-R/CENPR/HSU37139/NRIF3/TAP20
ITGB3BP
Yes
wheat germ expression system
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers