missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human HSD17B12 Full-length ORF (AAH12536.1, 1 a.a. - 98 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00051144-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16119692

  • 359.00€ / 10µg

Estimated Shipment: 23-09-2022
to see stock.
Add to basket

Description

Description

The enzyme 17-beta hydroxysteroid dehydrogenase-12 (HSD17B12) uses NADPH to reduce 3-ketoacyl-CoA to 3-hydroxyacyl-CoA during the second step of fatty acid elongation.[supplied by OMIM]

Sequence: MESALPAAGFLYWVGAGTVAYLALRISYSLFTALRVWGVGNEAGVGPGLGEWAVVTGSTDGIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEISNYT
Specifications

Specifications

AAH12536.1
Liquid
51144
HSD17B12 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MESALPAAGFLYWVGAGTVAYLALRISYSLFTALRVWGVGNEAGVGPGLGEWAVVTGSTDGIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEISNYT
RUO
HSD17B12
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.7kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KAR/SDR12C1
HSD17B12
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers