missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human HOXB9 Partial ORF (NP_076922.1, 1 a.a. - 98 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003219-Q02.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16034175

  • 518.16€ / 25µg

Estimated Shipment: 07-01-2022
Add to basket

Description

Description

This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of leukemia, prostate cancer and lung cancer. [provided by RefSeq]

Sequence: MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTW
Specifications

Specifications

NP_076922.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTW
RUO
HOXB9
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
3219
HOXB9 (Human) Recombinant Protein (Q02)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HOX-2.5/HOX2/HOX2E
HOXB9
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers