missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human HOXB4 Partial ORF (NP_076920, 1 a.a. - 60 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifications
| Accession Number | NP_076920 |
|---|---|
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 3214 |
| Molecular Weight (g/mol) | 32.34kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16094155
|
Abnova™
H00003214-Q01.25UG |
25 ug |
508.00€
25µg |
Estimated Shipment: 31-05-2024
Log in to see stock. |
|||||
|
16084155
|
Abnova™
H00003214-Q01.10UG |
10 ug |
335.00€
10µg |
Estimated Shipment: 31-05-2024
Log in to see stock. |
|||||
Description
This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Intracellular or ectopic expression of this protein expands hematopoietic stem and progenitor cells in vivo and in vitro, making it a potential candidate for therapeutic stem cell expansion. [provided by RefSeq]
Sequence: MAMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFGRRAACSpecifications
| NP_076920 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.34kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| HOX-2.6/HOX2/HOX2F | |
| HOXB4 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 3214 | |
| HOXB4 (Human) Recombinant Protein (Q01) | |
| MAMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFGRRAAC | |
| RUO | |
| HOXB4 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |