missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FOXQ1 Partial ORF (NP_150285.3, 133 a.a. - 223 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00094234-Q02.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16015755

  • 341.70€ / 10µg

Estimated Shipment: 20-01-2022
Add to basket

Description

Description

FOXQ1 is a member of the FOX gene family, which is characterized by a conserved 110-amino acid DNA-binding motif called the forkhead or winged helix domain. FOX genes are involved in embryonic development, cell cycle regulation, tissue-specific gene expression, cell signaling, and tumorigenesis (Bieller et al., 2001 [PubMed 11747606]).[supplied by OMIM]

Sequence: RDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHRAPVP
Specifications

Specifications

NP_150285.3
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.64kDa
12.5% SDS-PAGE Stained with Coomassie Blue
RDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHRAPVP
RUO
FOXQ1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
94234
FOXQ1 (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HFH1
FOXQ1
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers