missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human FGF9 Partial ORF (NP_002001, 99 a.a. - 208 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifications
| Accession Number | NP_002001 |
|---|---|
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 2254 |
| Molecular Weight (g/mol) | 37.84kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16104951
|
Abnova™
H00002254-Q01.25ug |
25 ug |
508.00€
25µg |
Estimated Shipment: 23-10-2024
Log in to see stock. |
|||||
|
16194941
|
Abnova™
H00002254-Q01.10ug |
10 ug |
335.00€
10µg |
Estimated Shipment: 23-10-2024
Log in to see stock. |
|||||
Description
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homolog of this gene was found to be dependent on Sonic hedgehog (Shh) signaling. Mice lacking the homolog gene displayed a male-to-female sex reversal phenotype, which suggested a role in testicular embryogenesis. [provided by RefSeq]
Sequence: SIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQSSpecifications
| NP_002001 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.84kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| GAF/HBFG-9/MGC119914/MGC119915 | |
| FGF9 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 2254 | |
| FGF9 (Human) Recombinant Protein (Q01) | |
| SIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS | |
| RUO | |
| FGF9 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |