missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ERF Partial ORF (AAH22231, 181 a.a. - 290 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human ERF Partial ORF (AAH22231, 181 a.a. - 290 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: p-7094048

Used for AP, Array, ELISA, WB-Re

335.00€ - 508.00€

Specifications

Accession Number	AAH22231
For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez)	2077
Molecular Weight (g/mol)	37.73kDa

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16174641 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00002077-Q01.25UG	25 ug	508.00€ 25µg View alternative products Save Up to »	Estimated Shipment: 03-06-2024 Log in to see stock.	Add to basket

16164641 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00002077-Q01.10UG	10 ug	335.00€ 10µg View alternative products Save Up to »	Estimated Shipment: 03-06-2024 Log in to see stock.	Add to basket

Description

Members of the ETS family of transcription factors, such as ERF, regulate cell proliferation and differentiation. They share a highly conserved DNA-binding domain, the ETS domain, that recognizes the sequence GGAA/T (de Castro et al., 1997 [PubMed 9192842]). For further information on ETS transcription factors, see ETS1 (MIM 164720).[supplied by OMIM]

Sequence: LGRGSVSDCSDGTSELEEPLGEDPRARPPGPPDLGAFRGPPLARLPHDPGVFRVYPRPRGGPEPLSPFPVSPLAGPGSLLPPQLSPALPMTPTHLAYTPSPTLSPMYPSG

Specifications

Accession Number	AAH22231
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	37.73kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	PE-2/PE2
Gene Symbol	ERF
Recombinant	Recombinant
Expression System	wheat germ expression system

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	2077
Name	ERF (Human) Recombinant Protein (Q01)
Immunogen	LGRGSVSDCSDGTSELEEPLGEDPRARPPGPPDLGAFRGPPLARLPHDPGVFRVYPRPRGGPEPLSPFPVSPLAGPGSLLPPQLSPALPMTPTHLAYTPSPTLSPMYPSG
Regulatory Status	RUO
Common Name	ERF
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

Abnova™ Human ERF Partial ORF (AAH22231, 181 a.a. - 290 a.a.) Recombinant Protein with GST-tag at N-terminal

Specifications

Description

Specifications

Documents