missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human DEFB4 Full-length ORF (NP_004933.1, 1 a.a. - 64 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00001673-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16124011

  • 359.00€ / 10µg

Estimated Shipment: 06-10-2022
to see stock.
Add to basket

Description

Description

Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation. [provided by RefSeq]

Sequence: MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Specifications

Specifications

NP_004933.1
Liquid
1673
DEFB4 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
RUO
DEFB4
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.4kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DEFB-2/DEFB102/DEFB2/HBD-2/SAP1
DEFB4
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers