missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human DBC1 Partial ORF (NP_055433, 662 a.a. - 761 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00001620-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16193911

  • 349.00€ / 10µg

Estimated Shipment: 03-11-2023
to see stock.
Add to basket

Description

Description

This gene is located within a chromosomal region that shows loss of heterozygosity in some bladder cancers. It contains a 5' CpG island that may be a frequent target of hypermethylation, and it may undergo hypermethylation-based silencing in some bladder cancers. [provided by RefSeq]

Sequence: LRFNADLLRSAVQQVNQSYTQGGQFYSSSSVMLLLLDIRDRINRLAPPVAPGKPQLDLFSCMLKHRLKLTNSEIIRVNHALDLYNTEILKQSDQMTAKLC
Specifications

Specifications

NP_055433
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LRFNADLLRSAVQQVNQSYTQGGQFYSSSSVMLLLLDIRDRINRLAPPVAPGKPQLDLFSCMLKHRLKLTNSEIIRVNHALDLYNTEILKQSDQMTAKLC
RUO
DBC1
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
1620
DBC1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DBCCR1/FAM5A
DBC1
Recombinant
wheat germ expression system
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers