missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human COX8A Full-length ORF (NP_004065.1, 1 a.a. - 69 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifications
| Accession Number | NP_004065.1 |
|---|---|
| For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 1351 |
| Molecular Weight (g/mol) | 34kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16103441
|
Abnova™
H00001351-P01.10UG |
10 ug |
335.00€
10µg |
Estimated Shipment: 31-05-2024
Log in to see stock. |
|||||
|
16113441
|
Abnova™
H00001351-P01.25UG |
25 ug |
508.00€
25µg |
Estimated Shipment: 31-05-2024
Log in to see stock. |
|||||
Description
The protein encoded by this gene is the terminal enzyme of the respiratory chain, coupling the transfer of electrons from cytochrome c to molecular oxygen, with the concomitant production of a proton electrochemical gradient across the inner mitochondrial membrane. In addition to 3 mitochondrially encoded subunits, which perform the catalytic function, the eukaryotic enzyme contains nuclear-encoded smaller subunits, ranging in number from 4 in some organisms to 10 in mammals. It has been proposed that nuclear-encoded subunits may be involved in the modulation of the catalytic function. This gene encodes one of the nuclear-encoded subunits. [provided by RefSeq]
Sequence: MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPESpecifications
| NP_004065.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 34kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE | |
| RUO | |
| COX8A | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 1351 | |
| COX8A (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| COX/COX8/COX8-2/COX8L/VIII/VIII-L | |
| COX8A | |
| Recombinant | |
| wheat germ expression system |