missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CNN2 Partial ORF (NP_004359.1, 193 a.a. - 290 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00001265-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16156484

  • 359.00€ / 10µg

Estimated Shipment: 04-08-2022
to see stock.
Add to basket

Description

Description

The protein encoded by this gene, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The encoded protein could play a role in smooth muscle contraction and cell adhesion. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: PKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDC
Specifications

Specifications

NP_004359.1
Liquid
1265
CNN2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CNN2
Wheat Germ (in vitro)
GST
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDC
RUO
CNN2
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers