missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CDC2L6 Partial ORF (NP_055891.1, 1 a.a. - 114 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00023097-Q02.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16025315

  • 341.70€ / 10µg

Estimated Shipment: 06-01-2022
Add to basket

Description

Description

This gene encodes a protein that is one of the components of the Mediator coactivator complex. The Mediator complex is a multiprotein complex required for transcriptional activation by DNA binding transcription factors of genes transcribed by RNA polymerase II. The protein encoded by this gene is similar to cyclin-dependent kinase 8 which can also be a component of the Mediator complex. [provided by RefSeq]

Sequence: MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGISMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRAS
Specifications

Specifications

NP_055891.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
38.28kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGISMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRAS
RUO
CDC2L6
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
23097
CDC2L6 (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CDK11/KIAA1028/bA346C16.3
CDC2L6
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers