missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CAMK1G Partial ORF (AAH32787, 371 a.a. - 476 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00057172-Q01.10ug

Product Code. 16192573

Quantity

Estimated Shipment: 23-10-2024
to see stock.

Add to basket

This item is not returnable. View return policy

Description

This gene encodes a protein similar to calcium/calmodulin dependent protein kinase, however, its exact function is not known. [provided by RefSeq]

Sequence: TQLPCQHGRRPTAPGGRSLNCLVNGSLHISSSLVPMHQGSLAAGPCGCCSSCLNIGSKGKSSYCSEPTLLKKANKKQNFKSEVMVPVKASGSSHCRAGQTGVCLIM

Specifications

Accession Number	AAH32787
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	37.29kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	TQLPCQHGRRPTAPGGRSLNCLVNGSLHISSSLVPMHQGSLAAGPCGCCSSCLNIGSKGKSSYCSEPTLLKKANKKQNFKSEVMVPVKASGSSHCRAGQTGVCLIM
Regulatory Status	RUO
Common Name	CAMK1G
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	57172
Name	CAMK1G (Human) Recombinant Protein (Q01)
Quantity	10 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	CLICKIII/VWS1/dJ272L16.1
Gene Symbol	CAMK1G
Recombinant	Recombinant
Expression System	wheat germ expression system

Product Suggestions

Description