missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human BRAF Partial ORF (NP_004324, 346 a.a. - 445 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000673-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16023695

  • 518.16€ / 25µg

Estimated Shipment: 21-01-2022
Add to basket

Description

Description

This gene encodes a protein belonging to the raf/mil family of serine/threonine protein kinases. This protein plays a role in regulating the MAP kinase/ERKs signaling pathway, which affects cell division, differentiation, and secretion. Mutations in this gene are associated with cardiofaciocutaneous syndrome, a disease characterized by heart defects, mental retardation and a distinctive facial appearance. Mutations in this gene have also been associated with various cancers, including non-Hodgkin lymphoma, colorectal cancer, malignant melanoma, thyroid carcinoma, non-small cell lung carcinoma, and adenocarcinoma of lung. A pseudogene, which is located on chromosome X, has been identified for this gene. [provided by RefSeq]

Sequence: FRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRD
Specifications

Specifications

NP_004324
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
FRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRD
RUO
BRAF
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
673
BRAF (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
B-RAF1/BRAF1/FLJ95109/MGC126806/MGC138284/RAFB1
BRAF
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers