missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human AVEN Partial ORF (NP_065104.1, 71 a.a. - 170 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00057099-Q02.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16015605

  • 518.16€ / 25µg

Estimated Shipment: 30-12-2021
Add to basket

Description

Description

Sequence: APRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTDFSVLLSSAGDSFSQFRFAEEKEWDSEASCP
Specifications

Specifications

NP_065104.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
APRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTDFSVLLSSAGDSFSQFRFAEEKEWDSEASCP
RUO
AVEN
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
57099
AVEN (Human) Recombinant Protein (Q02)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PDCD12
AVEN
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers