missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ANXA4 Partial ORF (NP_001144, 224 a.a. - 319 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifications
| Accession Number | NP_001144 |
|---|---|
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 307 |
| Molecular Weight (g/mol) | 36.3kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16114684
|
Abnova™
H00000307-Q01.25UG |
25 ug |
508.00€
25µg |
Estimated Shipment: 29-05-2024
Log in to see stock. |
|||||
|
16104684
|
Abnova™
H00000307-Q01.10UG |
10 ug |
335.00€
10µg |
Estimated Shipment: 29-05-2024
Log in to see stock. |
|||||
Description
Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. [provided by RefSeq]
Sequence: QSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGSpecifications
| NP_001144 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.3kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ANX4/DKFZp686H02120/MGC75105/PIG28/ZAP36 | |
| ANXA4 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 307 | |
| ANXA4 (Human) Recombinant Protein (Q01) | |
| QSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGG | |
| RUO | |
| ANXA4 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |