missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ANTXR2 Partial ORF (NP_477520.2, 241 a.a. - 310 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human ANTXR2 Partial ORF (NP_477520.2, 241 a.a. - 310 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: p-7103137

Used for AP, Array, ELISA, WB-Re

335.00€ - 508.00€

Specifications

Accession Number	NP_477520.2
For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez)	118429
Molecular Weight (g/mol)	33.44kDa

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16131597 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00118429-Q01.25UG	25 ug	508.00€ 25µg View alternative products Save Up to »	Estimated Shipment: 31-05-2024 Log in to see stock.	Add to basket

16121597 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00118429-Q01.10UG	10 ug	335.00€ 10µg View alternative products Save Up to »	Estimated Shipment: 31-05-2024 Log in to see stock.	Add to basket

Description

This gene encodes a receptor for anthrax toxin. The protein binds to collagen IV and laminin, suggesting that it may be involved in extracellular matrix adhesion. Mutations in this gene cause juvenile hyaline fibromatosis and infantile systemic hyalinosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: GRGFMLGSRNGSVLCTYTVNETYTTSVKPVSVQLNSMLCPAPILNKAGETLDVSVSFNGGKSVISGSLIV

Specifications

Accession Number	NP_477520.2
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	33.44kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	CMG-2/CMG2/FLJ31074/ISH/JHF/MGC111533/MGC45856
Gene Symbol	ANTXR2
Recombinant	Recombinant
Expression System	wheat germ expression system

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	118429
Name	ANTXR2 (Human) Recombinant Protein (Q01)
Immunogen	GRGFMLGSRNGSVLCTYTVNETYTTSVKPVSVQLNSMLCPAPILNKAGETLDVSVSFNGGKSVISGSLIV
Regulatory Status	RUO
Common Name	ANTXR2
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

Abnova™ Human ANTXR2 Partial ORF (NP_477520.2, 241 a.a. - 310 a.a.) Recombinant Protein with GST-tag at N-terminal

Specifications

Description

Specifications

Documents