missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human AKAP7 Partial ORF (NP_057461.1, 2 a.a. - 115 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009465-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16025175

  • 518.16€ / 25µg

Estimated Shipment: 29-12-2021
Add to basket

Description

Description

This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. Additional variants exist, but their full-length natures have not been determined. [provided by RefSeq]

Sequence: SEEFEANTMDSLVDMPFATVDIQDDCGITDEPQINLKRSQENEWVKSDQVKKRKKKRKDYQPNYFLSIPITNKEIIKGIKILQNAIIQQDERLAKAMVSDGSFHITLLVMQLLN
Specifications

Specifications

NP_057461.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
38.28kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SEEFEANTMDSLVDMPFATVDIQDDCGITDEPQINLKRSQENEWVKSDQVKKRKKKRKDYQPNYFLSIPITNKEIIKGIKILQNAIIQQDERLAKAMVSDGSFHITLLVMQLLN
RUO
AKAP7
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
9465
AKAP7 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AKAP18
AKAP7
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers