missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DSCAM Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17835-100UL
This item is not returnable.
View return policy
Description
DSCAM Polyclonal antibody specifically detects DSCAM in Human samples. It is validated for ImmunofluorescenceSpecifications
DSCAM | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
CHD2-42, CHD2-52, Down syndrome cell adhesion molecule, human CHD2-52 down syndrome cell adhesion molecule, 10CHD2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: QDGGRVMNMAVPKAHRPGDLIHLPPYLRMDFLLNRGGPGTSRDLSLGQACLEPQKSRTLK | |
100 μg | |
Primary | |
Human | |
Purified |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
1826 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |