missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ DLX2 (Human) Recombinant Protein

Human DLX2 partial ORF (NP_004396.1, 1 a.a. - 110 a.a.) recombinant protein with GST tag at N-terminal.

Brand:  Abnova™ H00001746-Q02.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16033905

  • 341.70€ / 10µg

Estimated Shipment: 25-01-2022
Add to basket

Description

Description

  • Sequence: MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQQHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDL
Specifications

Specifications

NP_004396.1
distal-less homeobox 2
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DLX2
GST
1746
Wheat germ expression system
10 μg
TES-1, TES1
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers