missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cytochrome C Oxidase subunit 6c Antibody (4G4-2A8), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00001345-M01
This item is not returnable.
View return policy
Description
Cytochrome C Oxidase subunit 6c Monoclonal antibody specifically detects Cytochrome C Oxidase subunit 6c in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
Cytochrome C Oxidase subunit 6c | |
Monoclonal | |
Unconjugated | |
In 1x PBS, pH 7.4 | |
Cytochrome c oxidase polypeptide VIc, cytochrome c oxidase subunit 6C, cytochrome c oxidase subunit VIc, cytochrome c oxidase subunit VIc preprotein | |
COX6C (AAH00187, 1 a.a. ~ 75 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK | |
0.1 mg | |
Primary | |
Human | |
Purified |
Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
4G4-2A8 | |
Western Blot 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin | |
AAH00187 | |
Mouse | |
IgG purified | |
RUO | |
1345 | |
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
IgG1 κ |