missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CLNS1A (Human) Recombinant Protein

Human CLNS1A full-length ORF ( NP_001284, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00001207-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16163311

  • 359.00€ / 10µg

Estimated Shipment: 04-08-2022
to see stock.
Add to basket

Description

Description

  • Sequence: MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH
Specifications

Specifications

NP_001284
chloride channel, nucleotide-sensitive, 1A
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CLNS1A
GST
1207
Wheat germ expression system
10 μg
CLCI, CLNS1B, ICln
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers