missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CARD4 (Human) Recombinant Protein

Human CARD4 partial ORF ( AAH40339, 1 a.a. - 93 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00010392-Q02.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16025245

  • 518.16€ / 25µg

Estimated Shipment: 10-01-2022
Add to basket

Description

Description

  • Sequence: MEEQGHSEMEIIPSESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCACPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQL
Specifications

Specifications

AAH40339
nucleotide-binding oligomerization domain containing 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NOD1
GST
10392
Wheat germ expression system
25 μg
CARD4, CLR7.1, NLRC1
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers