Learn More
Abnova™ ASF1B Recombinant Protein (P01)
Human ASF1B full-length ORF (AAH36521, 1 to 202 a.a.) recombinant protein with GST-tag at N-terminal
335.00€ - 508.00€
Specifications
Accession Number | AAH36521 |
---|---|
For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
Gene ID (Entrez) | 55723 |
Molecular Weight (g/mol) | 48 |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16121723
|
Abnova™
H00055723-P01.10UG |
10 ug |
335.00€
10µg |
Estimated Shipment: 03-06-2024
Log in to see stock. |
|||||
16131723
|
Abnova™
H00055723-P01.25UG |
25 ug |
508.00€
25µg |
Estimated Shipment: 03-06-2024
Log in to see stock. |
|||||
Description
This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.
- Theoretical MW (kDa): 47.96
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFGQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPG
LLPENSMDCI
Best use within three months from the date of receipt of this protein.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
AAH36521 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
48 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
Wheat Germ (in vitro) | |
CIA-II/FLJ10604 | |
ASF1B | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Protein Array, ELISA, Western Blot | |
55723 | |
ASF1B (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ASF1B | |
Human | |
Recombinant | |
Solution |